PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0210s0074.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 277aa    MW: 30356 Da    PI: 6.9773
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0210s0074.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.91.5e-3088141155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Kalax.0210s0074.1.p  88 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 141
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05985144IPR017930Myb domain
SuperFamilySSF466892.42E-2085145IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-3087146IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-2489141IPR006447Myb domain, plants
PfamPF002491.0E-791140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MKEDESNWLS RWEEQLPSPD ELMPLSQTLI TPHLALVFDL HNPNNPQSTP LPAPTPSSLA  60
HPSSSEFENS GDLGSGAGGD EPARTLKRPR LVWTPQLHKR FVDAVAHLGI KNAVPKTIMQ  120
LMSVDGLTRE NVASHLQKYR LYLKRMQGHS NGGGGLASSD PATDHLFASS PVPAHFLHPV  180
RPGQDHFMPF VAPPQSGRPI WVTHPQLQQQ FHQQRQVGQV GHFGSPHSNG QFEHSFMTRQ  240
QAGPRMGAPP PYGEDVESGE ANGRRTVLTL FPTGDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-2187146463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036386.11e-116PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB43e-45PCL1_ARATH; Transcription factor LUX
TrEMBLA0A059A3P31e-116A0A059A3P3_EUCGR; Uncharacterized protein
STRINGPGSC0003DMT4000722131e-105(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.11e-85G2-like family protein